Open-source GitHub repos for GTM engineering
Agent skills, MCP servers, scrapers, CRM, enrichment and outreach projects you can run yourself. Each row gives the licence, when it was last updated and the install command, so you can try one in a minute.
- 198repos
- 12categories
- 69ship an MCP server
- 78ship Claude skills
Showing 40 of 198 repos
jaizendra-netizen/signal-outbound-lead-gen-systemBuilt by OneGTMLabOneGTMLab's reference build for turning LinkedIn buying signals into meetings, with Supabase as the system of record and Claude Code as operator.Outreach agents2MIT3 mo agogit clone https://github.com/jaizendra-netizen/signal-outbound-lead-gen-system.git
Use it to Signal-to-meeting outbound pipeline; Verify and enrich signal leads.
Licence MIT: permissive: use, change and sell it, keep the notice.
Worth knowing Our own repo. Uses ClearCue, Supabase, Apify, enrichment APIs and HeyReach; placeholder keys only.
n8n-io/n8nA fair-code workflow automation platform with a visual builder, custom code and AI agent nodes, self-hosted or cloud.Workflow automation209kSustainable Usethis monthdocker run -it --rm --name n8n -p 5678:5678 -v n8n_data:/home/node/.n8n docker.n8n.io/n8nio/n8n
Use it to Enrichment and routing workflows; Webhook-driven CRM automations.
Licence Sustainable Use: source-available: you can read and run it, with limits on how.
Worth knowing LICENSE file: Sustainable Use License (fair-code, source-available, not OSI open source); .ee files need an enterprise licence. Cloud also offered.
aiapisautomationclidata-flowdevelopmentintegration-frameworkintegrationsipaaslow-codelow-code-platformmcp
firecrawl/firecrawlAn API and open-source engine that searches, scrapes, crawls and maps websites into clean Markdown or structured JSON for AI agents.Scraping195kAGPL-3.0this monthpip install firecrawl
Use it to Scrape company homepages for qualification; Map every URL on a site.
Licence AGPL-3.0: copyleft: changes you distribute or serve must stay open.
Worth knowing AGPL-3.0. Self-host or use the hosted API.
aiai-agentsai-crawlerai-scrapingai-searchcrawlerdata-extractionhtml-to-markdownllmmarkdownscraperscraping
anthropics/skillsAnthropic's public repository of Agent Skills, including document skills for Word, Excel, PowerPoint and PDF and example skills.Agent skills184kNonethis month/plugin marketplace add anthropics/skills
Use it to Generate decks and docs from agents; Learn the skill format.
Licence None: no licence file: default copyright applies, ask before reuse.
Worth knowing No licence detected by GitHub at repo level.
agent-skills
langgenius/difyA platform for building agentic workflows and RAG pipelines in a visual workspace, self-hosted or in the cloud.Workflow automation159kApache-2.0 + termsthis monthdocker compose up -d
Use it to Internal research and qualification agents; RAG over sales collateral.
Licence Apache-2.0 + terms: source-available: you can read and run it, with limits on how.
Worth knowing LICENSE file: modified Apache-2.0 with added conditions (no multi-tenant service without permission; keep logo and copyright). Cloud also offered.
agentagentic-aiagentic-frameworkagentic-workflowaiautomationclaudedeepseekgenaigptllmlow-code
browser-use/browser-useA Python library for AI browser agents that navigate sites, fill forms and extract data with any LLM, with an optional cloud.Scraping119kMITthis monthuv add browser-use
Use it to Research tasks that need a browser; Form and portal automation.
Licence MIT: permissive: use, change and sell it, keep the notice.
Worth knowing Cloud browsers offered as a paid option.
ai-agentsai-toolsbrowser-agentbrowser-automationbrowser-usecdpcloud-browsercomputer-useheadless-browserllmmcpplaywright
thedotmack/claude-memCaptures what a coding agent does in each session, compresses it and injects relevant context into later sessions.Agent memory103kApache-2.0this monthnpx claude-mem install
Use it to Keep client context between sessions; Recall past campaign decisions.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
aiai-agentsai-memoryanthropicartificial-intelligencechromadbclaudeclaude-agent-sdkclaude-agentsclaude-codeclaude-code-pluginclaude-skills
sherlock-project/sherlockA CLI that finds social media accounts by username across 400+ networks.Social and OSINT94.9kMITthis monthpipx install sherlock-project
Use it to Find a prospect's other social profiles; Check brand handle availability.
Licence MIT: permissive: use, change and sell it, keep the notice.
clicticybersecurityforensicshacktoberfestinformation-gatheringinfoseclinuxosintpentestingpythonpython3
modelcontextprotocol/serversReference MCP server implementations from the MCP steering group, such as fetch, git and memory, plus pointers to the MCP Registry.MCP servers91.6kMIT / Apache-2.0this monthnpx -y @modelcontextprotocol/server-memory
Use it to Learn how MCP servers are built; Fetch and memory tools for agents.
Licence MIT / Apache-2.0: permissive: use, change and sell it, keep the notice.
Worth knowing LICENSE file: project is moving from MIT to Apache-2.0. README describes these as educational reference servers, not production-ready.
D4Vinci/ScraplingA Python scraping framework covering fast requests, browser rendering, parsing and concurrent crawls, usable from code, CLI or its MCP server.Scraping89.7kBSD-3-Clausethis monthpip install scrapling
Use it to Scrape company sites into Markdown; Crawl directories for lead lists.
Licence BSD-3-Clause: permissive: use, change and sell it, keep the notice.
aiai-scrapingautomationcrawlercrawlingcrawling-pythondatadata-extractionmcpmcp-serverplaywrightpython
unclecode/crawl4aiAn open-source crawler and scraper that turns websites into clean Markdown or JSON for AI agents, self-hosted or via its cloud.Scraping86.2kApache-2.0this monthpip install -U crawl4ai
Use it to Homepage text for qualification; Crawl sites into Markdown.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
Worth knowing Cloud API also offered.
aiai-agentscrawlerdata-extractionllmmarkdownmcpopen-sourceplaywrightpythonragscraper
ComposioHQ/awesome-claude-skillsA curated list of Claude skills and plugins across use cases, including business, marketing and app-action skills.Agent skills77.9kNone1 mo agogit clone https://github.com/ComposioHQ/awesome-claude-skills.git
Use it to Find skills for a GTM task; Discover app-action plugins.
Licence None: no licence file: default copyright applies, ask before reuse.
Worth knowing No licence detected by GitHub.
agent-skillsai-agentsantigravityautomationclaudeclaude-codecodexcomposiocursordeveloper-toolsgemini-climcp
mem0ai/mem0A memory layer for AI agents and apps that stores and retrieves long-term context across sessions.Agent memory67.8kApache-2.0this monthpip install mem0ai
Use it to Remember prospect context across runs; Personalised agent replies.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
Worth knowing Managed platform also offered.
agentic-memoryagentic-memory-systemagentsaiai-agentschatgptgenaillmlong-term-memorymemorymemory-managementpython
mvanhorn/last30days-skillAn agent skill that summarises the last 30 days of talk on a topic across Reddit, X, YouTube and Hacker News.Research agents65.4kMITthis monthnpx skills add mvanhorn/last30days-skill -g
Use it to Check what buyers discuss this month; Validate post topics against live talk.
Licence MIT: permissive: use, change and sell it, keep the notice.
ai-promptsai-skillblueskyclaudeclaude-codeclawhubdeep-researchhackernewsinstagramopenclawpolymarketrecency
nocodb/nocodbA self-hostable Airtable-style database UI with automatic APIs on top of Postgres or SQLite.Workflow automation65.4kSustainable Usethis monthgit clone https://github.com/nocodb/nocodb.git
Use it to Self-hosted lead tables; Shared views over a GTM database.
Licence Sustainable Use: source-available: you can read and run it, with limits on how.
Worth knowing LICENSE file: Sustainable Use License (fair-code, source-available, not OSI open source). Cloud also offered.
airtableairtable-alternativeautomatic-apihacktoberfestlow-codeno-codeno-code-databaseno-code-platformpostgresqlrest-apirestful-apispreadsheet
scrapy/scrapyA Python web scraping framework for extracting structured data from websites.Scraping65kBSD-3-Clausethis monthpip install scrapy
Use it to Large directory crawls; Scheduled data collection.
Licence BSD-3-Clause: permissive: use, change and sell it, keep the notice.
crawlercrawlingframeworkhacktoberfestpythonscrapingweb-scrapingweb-scraping-python
blader/humanizerAn agent skill that rewrites AI-generated text so it reads as human-written, based on Wikipedia's signs of AI writing.Agent skills60.5kMITthis month/plugin marketplace add blader/humanizer
Use it to Clean AI tells from cold emails; Edit LinkedIn post drafts.
Licence MIT: permissive: use, change and sell it, keep the notice.
agent-skillsai-humanizerai-writingchatgptclaudeclaude-codecodexcursorhumanize-ai-texthumanizerllmprompt-engineering
twentyhq/twentyAn open-source CRM that technical teams can customise, version and extend with code, self-hosted or in the cloud.CRM and RevOps59.7kAGPL corethis monthnpm install -g twenty
Use it to Custom CRM for a GTM team; CRM objects defined as code.
Licence AGPL core: copyleft: changes you distribute or serve must stay open.
Worth knowing LICENSE file: mostly AGPLv3; some files under a commercial licence and some packages MIT. Cloud also offered.
crmcrm-systemcustomergood-first-issuegraphqlhacktoberfestjavascriptmarketingmonoreponestjsopen-sourcepostgresql
Zie619/n8n-workflowsA large searchable collection of n8n workflow JSON files with a local browser and online index.Workflow automation57.1kMIT4 mo agogit clone https://github.com/Zie619/n8n-workflows.git
Use it to Find a starting workflow for a GTM task; Study CRM and email automations.
Licence MIT: permissive: use, change and sell it, keep the notice.
coreyhaines31/marketingskillsAgent skills for conversion optimisation, copywriting, SEO, analytics and growth engineering, built for technical marketers and founders.Agent skills56.5kMITthis monthnpx skills add coreyhaines31/marketingskills
Use it to Landing page CRO reviews; Copywriting and SEO tasks.
Licence MIT: permissive: use, change and sell it, keep the notice.
agent-skillsai-agentsai-seoclaudeclaude-codeclaude-code-pluginclaude-skillscodexcontent-marketingconversion-rate-optimizationcopywritingcursor
odoo/odooA suite of open-source business apps including CRM, website, e-commerce, marketing and accounting that can run standalone or together.CRM and RevOps55.3kLGPL-3.0this monthgit clone https://github.com/odoo/odoo.git
Use it to CRM inside a full ERP; Quote-to-cash for services firms.
Licence LGPL-3.0: copyleft: changes you distribute or serve must stay open.
Worth knowing LICENSE file: LGPL-3.0.
appsbusinesserpmanagementodooodoo-appspython
huginn/huginnA self-hosted system of agents that watch websites, feeds, inboxes and webhooks and take actions when events occur.Workflow automation50.1kMITthis monthdocker run -it -p 3000:3000 ghcr.io/huginn/huginn
Use it to Watch sites and feeds for signals; Email alerts on page changes.
Licence MIT: permissive: use, change and sell it, keep the notice.
agentautomationfeedfeedgeneratorhuginnmonitoringnotificationsrssscraperwebscraping
PostHog/posthogA product analytics platform with web analytics, session replay, feature flags, experiments and an MCP server.Analytics40.4kMIT corethis monthnpx -y @posthog/wizard@latest
Use it to Product usage signals for PLG sales; Conversion funnels and experiments.
Licence MIT core: permissive: use, change and sell it, keep the notice.
Worth knowing LICENSE file: MIT (Expat) outside ee/; ee/ has its own licence. Cloud also offered.
ab-testingai-analyticsanalyticscdpdata-warehouseexperimentsfeature-flagsjavascriptproduct-analyticspythonreactsession-replay
umami-software/umamiA privacy-first web and product analytics platform for traffic, campaigns, conversions and revenue, self-hosted or cloud.Analytics39.7kMITthis monthgit clone https://github.com/umami-software/umami.git
Use it to Campaign and UTM tracking; Simple analytics for client sites.
Licence MIT: permissive: use, change and sell it, keep the notice.
Worth knowing Cloud also offered.
analyticsaudience-segmentationchartscohort-analysisgoogle-analyticsproduct-analyticsstatisticsuser-journeyweb-analytics
searxng/searxngA metasearch engine whose users are neither tracked nor profiled.Scraping38.8kAGPL-3.0this monthgit clone https://github.com/searxng/searxng.git
Use it to Free search backend for agents; Private web research.
Licence AGPL-3.0: copyleft: changes you distribute or serve must stay open.
Worth knowing AGPL-3.0.
bingbravedegoogleduckduckgogooglemetasearchprivacypythonqwantsearchsearch-enginesearx
microsoft/playwright-mcpAn MCP server that lets LLMs drive a browser through Playwright accessibility snapshots instead of screenshots.MCP servers38.6kApache-2.0this monthclaude mcp add playwright npx @playwright/mcp@latest
Use it to Agent browsing for research; Fill web forms from Claude.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
mcpplaywright
lightpanda-io/browserA headless browser written from scratch in Zig for AI agents and automation, compatible with Playwright and Puppeteer over CDP.Scraping37kAGPL-3.0this monthbrew install lightpanda-io/browser/lightpanda
Use it to Cheaper large-scale page rendering; Fast headless scraping.
Licence AGPL-3.0: copyleft: changes you distribute or serve must stay open.
Worth knowing AGPL-3.0.
browserbrowser-automationcdpheadlesslightpandaplaywrightpuppeteerzig
VoltAgent/awesome-agent-skillsA curated collection of official agent skills from leading development teams and the community.Agent skills36.3kMITthis monthgit clone https://github.com/VoltAgent/awesome-agent-skills.git
Use it to Find official vendor skills; Discover skills for a GTM tool.
Licence MIT: permissive: use, change and sell it, keep the notice.
agent-skillsai-agentsawesomeawesome-listclaude-codeclaude-code-skillsclaude-skillscodexcodex-skillscursorcursor-skillsgemini-skills
dgtlmoon/changedetection.ioA self-hosted tool that watches web pages and sends alerts by email, Slack or webhook when content changes.Scraping35.3kApache-2.0this monthpip3 install changedetection.io
Use it to Watch competitor pricing pages; Alert on careers page changes.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
Worth knowing Paid hosted plan also offered.
back-in-stockchange-alertchange-detectionchange-monitoringmonitoringnotificationsrestock-monitorrssself-hostedurl-monitorweb-scrapingwebsite-change-detection
lissy93/web-checkAn all-in-one tool that reports on any website's DNS, server, security setup, technologies and more.Social and OSINT35.2kMITthis monthgit clone https://github.com/Lissy93/web-check.git
Use it to Tech and hosting research on accounts; Domain checks before outreach.
Licence MIT: permissive: use, change and sell it, keep the notice.
osintprivacysecuritysecurity-toolssysadmin
topoteretes/cogneeAn AI memory platform that turns documents, code and conversations into a self-hosted knowledge graph agents can search.Agent memory32.7kApache-2.0this monthuv pip install "cognee[gliner]"
Use it to Company brain for agents; Graph over account research.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
agent-memoryagent-skillsaiai-agentsai-memorycognitive-architecturecognitive-memorycontext-engineeringcontributions-welcomegood-first-issuegood-first-prgraph-database
ScrapeGraphAI/Scrapegraph-aiA Python library that builds LLM-driven scraping pipelines where you describe the data you want and it extracts it.Scraping32.2kMITthis monthpip install scrapegraphai
Use it to Extract firmographics from websites; Structured data from directories.
Licence MIT: permissive: use, change and sell it, keep the notice.
ai-crawlerai-scrapingai-searchcrawlerdata-extractionfirecrawl-alternativelarge-language-modelllmmarkdownragscrapingscraping-python
getzep/graphitiA framework for building temporal knowledge graphs that track how facts change over time, used as memory for AI agents.Agent memory32.2kApache-2.0this monthpip install graphiti-core
Use it to Account memory that tracks changes; Relationship graphs for agents.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
agentsgraphllmsrag
googleworkspace/cliA CLI for Gmail, Drive, Calendar, Sheets and Docs built from Google's Discovery Service, with 40+ agent skills.Workflow automation31.9kApache-2.0this monthnpm install -g @googleworkspace/cli
Use it to Agents reading and writing Sheets; Gmail and Calendar automation.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
Worth knowing README notes it is not an officially supported Google product.
agent-skillsai-agentautomationclidiscovery-apigemini-cli-extensiongoogle-admingoogle-apigoogle-calendargoogle-chatgoogle-docsgoogle-drive
stanford-oval/stormAn LLM system that researches a topic from several perspectives and writes a full-length report with citations.Research agents31.7kMIT1 yr agogit clone https://github.com/stanford-oval/storm.git
Use it to Long-form market briefs; Industry primers for new verticals.
Licence MIT: permissive: use, change and sell it, keep the notice.
Worth knowing Research preview. Uses LLM and search APIs.
agentic-ragdeep-researchemnlp2024knowledge-curationlarge-language-modelsnaaclnlpreport-generationretrieval-augmented-generation
supermemoryai/supermemoryA memory and context engine that learns facts and user profiles from conversations and serves relevant context, run locally or via API.Agent memory31.4kMITthis monthnpm install supermemory
Use it to Account memory for agents; Context across long campaigns.
Licence MIT: permissive: use, change and sell it, keep the notice.
Worth knowing Hosted API also offered.
agent-memoryai-memorycloudflare-kvcloudflare-pagescloudflare-workersdrizzle-ormmemorypostgresremixtailwindcsstypescriptvite
ComposioHQ/composioAn SDK and CLI that give AI agents authenticated tools for 1000+ apps such as Gmail, Slack and CRMs, with per-user sessions.MCP servers30.7kMITthis monthpip install composio composio-openai-agents openai-agents
Use it to Let agents act in CRM, Gmail and Slack; Trigger workflows from app events.
Licence MIT: permissive: use, change and sell it, keep the notice.
Worth knowing Needs a Composio API key.
agentic-aiagentsaiai-agentsaiagentsdeveloper-toolsfunction-callinggpt-4javascriptjsllmllmops
assafelovic/gpt-researcherAn autonomous research agent that plans questions, searches the web and local files, and writes cited research reports with any LLM.Research agents30.3kApache-2.0this monthpip install gpt-researcher
Use it to Company and market research reports; Account briefs before outreach.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
Worth knowing Uses web search APIs you configure.
agentaiautomationdeepresearchllmsmcpmcp-serverpythonresearchsearchwebscraping
simstudioai/simA workspace for building, deploying and monitoring AI agents and workflows with 270+ integrations, including HubSpot and Salesforce.Workflow automation29.9kApache-2.0this monthnpx sim-setup
Use it to Visual lead routing agents; CRM-connected AI workflows.
Licence Apache-2.0: permissive: use, change and sell it, keep the notice.
Worth knowing Cloud also offered.
agent-workflowagentic-workflowagentsaiaiagentsanthropicartificial-intelligenceautomationchatbotdeepseekgeminilow-code
plausible/analyticsA lightweight, cookie-free web analytics tool, self-hosted community edition or managed cloud.Analytics29.7kAGPL-3.0this monthgit clone https://github.com/plausible/analytics.git
Use it to Simple site analytics for clients; Campaign source tracking.
Licence AGPL-3.0: copyleft: changes you distribute or serve must stay open.
Worth knowing AGPL-3.0. Cloud also offered.
analyticsanalytics-dashboardclickhouseelixirgoogle-analyticsmarketingopen-source-analyticsphoenixplausible-analyticspostgresqlprivacyprivacy-friendly
No repo matches these filters.
Want it set up for you?
Tell us what you sell and who you sell to. We will show you which of these projects we would run for you, and how we would wire them into your stack.
